PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_DE2CF9613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 479aa    MW: 51670.7 Da    PI: 9.5603
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_DE2CF9613.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.4e-16409452548
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                            +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  Traes_1BL_DE2CF9613.1 409 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ 452
                            79***************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-15403452No hitNo description
SMARTSM003381.3E-12405477IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702407452IPR004827Basic-leucine zipper domain
CDDcd147076.98E-26409463No hitNo description
SuperFamilySSF579595.25E-11409454No hitNo description
PfamPF001702.6E-13409452IPR004827Basic-leucine zipper domain
PROSITE patternPS000360412427IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
VAHGFASGPI RQFLPSPPLP LPPWLPPPSP PPPFPNGRRQ TEPALTAARG LDPAPGGRES  60
RGCPVQFDAD SSWEVGAAEI RSPDLPPIRW SPSFPEEKSR RFVRRRVLCA VSWICGSATC  120
DRVFAGGKGA ALGIVVPEVF VPIGATSSRE RRFMIQAMAS QSQAGGGGGG GYAGPGQRGQ  180
AQGLARQGSL YSLTLDEVQS QLTEPLLSMN LDELLKSVFP DGVDPVGGVA GQSEPAPGLH  240
RQGSITMPPE LSKKTVDEVW KGIQDSPKRS GEEGIRRRRE RQPTFGEMTL EDFLVKAGVV  300
AEGHLKDPID LPANMGAVGS SVTAAAPSLN PGAHWLQQYL EPQHPSMAGP FMASHLGPQP  360
LSVATGAIME PIYPDGQITS PMLDALSDPQ TPRRKRGASD GVTDKVVERR QKRMIKNRES  420
AARSRARKQA YTNELENKVS RLEEENERLK KQKELDMMIT SAPPPEPKYQ LRRTSSAPV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264269DSPKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071120.0EU307112.2 Triticum aestivum FD-like 2 protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568219.11e-158PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014753472.11e-158PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-79AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLW5A6P00.0W5A6P0_WHEAT; Uncharacterized protein
STRINGMLOC_6534.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-73ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]